answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
katovenus [111]
2 years ago
15

4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y

our answer. FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNTGDVNELTANTITT 4b) How did you know how long to make the helix? Explain. 4c) What lead you to pick the region you did? Explain your answer.
Biology
1 answer:
arlik [135]2 years ago
7 0

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

You might be interested in
as you drive along the roadside, you and your friend notice a dead deer that apparently was struck by a car. Your friend comment
Mkey [24]
If it is the abdomen and not the stomach area i would say its from the heat. if you've ever seen a dead animal on the side of the road over the course of a few days, they start to swell from the sun beating down on them all day.
5 0
2 years ago
Read 2 more answers
Proton pumps are used in various ways by members of every domain of organisms: Bacteria, Archaea, and Eukarya. What does this mo
evablogger [386]

Answer:

The correct answer is A and D

Explanation:

According to Russell's conception that lies in natural proton gradients. He states that Four billion years ago, alkaline fluids bubbled to produce mildly acidic oceans (As CO2 levels were about a thousand times higher, and it reacts with H2O to form carbonic acid, rendering the oceans mildly acidic). Acidity is just a measure of proton concentration,  higher in the oceans than in vent fluids. This difference has given rise to a natural proton gradient across the vent membranes that had the same polarity (outside positive) which is similar to the electrochemical potential as modern cells have. This might be the reason that last universal common ancestors of all the three domains have evolved proton pumps.

6 0
2 years ago
A grassy meadow high in the Sierra Nevada Mountains of eastern California is known to support a variety of organisms. During the
gavmur [86]

Answer:

b) 1,000

Explanation:

In a typical food chain as described in this question, flow of energy occurs from one organism to another when they feed/fed upon. As one organism feeds, energy gets transferred to it. However, only about 10% of the available energy in the lower trophic level gets transferred because majority of the energy (about 90%) is lost as heat during metabolic processes of the organism.

Hence, if a flower contains approximately 100,000 units of energy and is fed on by butterflies. 10% of 100, 000 = 10,000 units gets transferred to the butterflies.

Likewise, the butterflies gets fed on by certain bird species. 10% of the available 10,000 units of energy in the butterfly gets transferred to the birds.

= 10/100 × 10,000 = 1000 units of energy.

4 0
2 years ago
A phylogeny of some land plants is shown above. Which statement correlates accurately with the tree shown above?
mezya [45]

Answer:

D - Flowering plants and ferns have a more recent common ancestor than they do with spike mosses

Explanation:

3 0
2 years ago
The first invertebrates to develop a true nervous system are
Rina8888 [55]

Answer:

Coelenterates are the first invertebrates to develop a true nervous system.

Explanation:

3 0
2 years ago
Other questions:
  • Use the drop-down menus to match each phrase below with the type of microscope it describes.
    11·2 answers
  • Which of the following structures would aid a cell in allowing more nutrients to be absorbed by the cell?
    9·1 answer
  • Which star do you think is the densest: Antares, Spica, or Polaris? Explain.
    9·2 answers
  • After a volcanic eruption has covered an area with lava, which of the following is the most likely order of succession in the re
    15·1 answer
  • A camel can survive several weeks without drinking water by simply eating green plants. When a camel does drink, however, it can
    15·2 answers
  • Total fiber refers to the sum of _____.
    8·1 answer
  • You have discovered a new coccoid-shaped microorganism with no nucleus, a rigid cell wall, and a diameter of 2 μm. Chemical test
    9·2 answers
  • Ten grams of hamburger were added to 90 ml of sterile buffer.
    5·1 answer
  • A mutant version of mouse-ear cress (Arabidopsis thaliana) has been engineered to convert it from a long-day plant to a short-da
    13·1 answer
  • Hector spent the last three months on a winter fishing boat in Alaska. He was doing research on population levels of fish for co
    5·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!