answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Jet001 [13]
2 years ago
4

A person counts the number of flowers she sees on different types of plants she records the data every week what is the independ

ent variable dependent variable constant and control
Biology
1 answer:
Luba_88 [7]2 years ago
4 0

Answer:

Independent variable: Different types of plants

Dependent variable: Number of flowers

Control group: None in this experiment

Constant: same time of recording

Explanation:

Independent variable in an experiment refers to the variable that is manipulated or changed by the experimenter in order to effect a response. In this experiment, the independent variable is the DIFFERENT TYPES OF PLANTS USED because it is what is changed by the person.

Dependent variable is the variable that the experimenter measures or records. In this case, the dependent variable is the NUMBER OF FLOWERS recorded for each type of plant.

The control group of an experiment is the group that does not receive any experimental treatment i.e. group placed on normal conditions for comparison. In this experiment, NO CONTROL GROUP was used or mentioned.

The constant or controlled variable is the variable that is kept constant or unchanged throughout the experiment in order not to influence the outcome. In this experiment, the person records the number of flowers on each plant at the SAME TIME (every week), hence, it is the constant.

You might be interested in
Loss of biodiversity matters not only with regard to mammals or other vertebrates, but also microbes. What statement below would
Romashka [77]

Answer:

B. Microbes may produce unique proteins useful in genetic research

Explanation:

Biodiversity refers to the diversity of living beings present on Earth. The biodiversity is a very important component of the ecosystem as these living organisms are interlinked with each other. Therefore, the loss of biodiversity will affect the ecosystem.

When we look at the biodiversity a layman considers the living organisms which can be seen with eyes but the diversity also exists at the level of the micro-organisms.

The man-made activities are not only harming the macroscopic but also microscopic organisms. The microbes play an important role in our life like these days they are used by the scientific community to study the genetic and related fields like molecular biology. The microbes produce proteins that are consumed by humans.

Thus, Option-B is correct.

8 0
2 years ago
Suppose the human trait for hair type is controlled by a simple dominant and recessive relationship at one locus. Curly hair, C,
Zepler [3.9K]

Answer:

The frequency of the dominant allele, C = 0.2234

and the heterozygous genotype, Cc= 0.1736

Explanation:

Given -  

Curly hair, C, is the dominant allele, and straight hair, c, is the recessive allele

Thus, C is dominant over c

The genotype frequency of curly hair is 52 in 131 students

so, remaining 131-52 = 79 are straight hair students.  

Since straight hair is a recessive allele , the genotypic frequency of "cc" is  

\frac{79}{131}\\0.6030

Frequency of "cc" is represented by q^{2}

Thus frequency of allele "q"  

= \sqrt{0.6030} \\= 0.7765

As per Hardy Weinberg's I equation -  

p+q=1\\p + 0.7765=1\\p = 0.2234

As per Hardy Weinberg's II equation -  

p^{2} +2pq + q^{2} =1\\0.2234^2+2pq+0.6030=1\\2pq= 0.1736

Hence,  

The frequency of the dominant allele, C = 0.2234

and the heterozygous genotype, Cc= 0.1736

7 0
2 years ago
Why is classification of species important in light of a changing environment and changing ecosystem
Nat2105 [25]

Answer:

In order for scientists to keep track of endangered species and discover new species that are created due to the constant change.

5 0
2 years ago
Suppose concordance data were collected from a cohort study of twins to study the genetic contribution to the onset of type 1 di
Dmitry_Shevchenko [17]

Answer:

The heritability of type 1 diabetes is likely high, indicating that genetics plays a larger role in the development of type 1 diabetes than the environment.

Explanation:

Identical twins are formed when a single zygote separates into two embryos after the process of fertilization. Hence, these twins arise from the same egg and sperm.

Fraternal twins arise when two different sperms fertilize two eggs at the same time.

Hence, we can say that the genotype of the identical twins is similar.

The results from concordance data prove that genetics play a higher role in type 1 diabetes.

7 0
2 years ago
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
2 years ago
Other questions:
  • What is the layer of bedrock that is near Earth's surface that forms a continuous shell around Earth called?
    8·1 answer
  • Based on this classification scheme, the European otter and the leopard are in the same ?
    8·2 answers
  • What is the main host type of bacteriophage?
    5·1 answer
  • Tay-sachs disease causes lysosomes to rupture. how would this affect the cell? check all that appl
    8·1 answer
  • Not all plants have seeds. what advantage do seeds provide a plant? not all plants have seeds. what advantage do seeds provide a
    13·1 answer
  • ) when someone applies for their california driver's license, they give _____ to be tested by breath or blood whenever requested
    12·1 answer
  • Albino trees exist in nature, but they're rare. These trees contain a gene mutation that causes them to lack chlorophyll, so the
    12·2 answers
  • Which statement best compares pseudopods in sarcodina and flagella in dinoflagellates?
    7·1 answer
  • Identify a dependent variable measured in the researcher’s experiment. Identify one control that the researcher could use to imp
    6·1 answer
  • Part B<br> What are the strengths and weaknesses of the cell model?
    5·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!