Answer:
A. associate scientists
<em>hop</em><em>e</em><em> this</em><em> answer</em><em> correct</em><em> </em><em>(</em><em>^</em><em>^</em><em>)</em><em>.</em><em>.</em>
New oceanic lithosphere is unable to form at mid ocean ridges. This is False. New oceanic lithosphere is able to form at mid-ocean ridges. This is where the New oceanic lithosphere is usually formed
Answer:
D) The encoded protein contains four repeats of a specific sequence.
Explanation:
The polymerase chain reaction is a technique used to replicate or amplify the amount of DNA sample.
The technique employs running the DNA samples on the gel through which the DNA samples run based on their sizes.
The large-sized DNA fragment runs to a less distance whereas the small-sized DNA run to a large distance.
In the given question, four sizes of DNA bands are formed in the ratio of 1:2:3:4 which shows that the proteins encoded by this DNA have four repeats of a specific sequence of the template strand. This was confirmed when the largest band sample was again used as a sample of PCR and the PCR resulted in the four bands in similar 1:2:3:4.
Thus, Option-D is the correct answer.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer: Workplace electrocusion
Explanation:
The human body is a good conductor of electricity. The workplace electrocution occurs due to electric shock. This leads to workplace injuries that may often lead to disabilities and can also be fetal. The workplace electrocution can also lead to cardiac arrest, and tissue damage due to thermal burns. The severity of injuries may depend upon the intensity of electricity, health of the victim and how the current flows in the body.
According to the given situation, the freshly mopped floor is a source of water and water, as well as metal, which is a good source of electricity. The electric wire is an energized source of electrical energy that will allow the flow of electric current in the body, as well as contact with the floor containing water, which will enhance the effect. Thus this is an example of workplace electrocution.
