The given passage depicts the chivalric value that Gawain is displaying in the excerpt is - loyalty to his king
He is loyal to the king and says he will stand by the king. This show his devotion and dedication towards the king. This proves his loyalty towards him.
So the correct answer is loyalty to his king.
Nope! Cells must have some sort of genetic material by which they form the new cell
<span>Baroreceptors are special receptors that detect changes in your blood pressure. Important baroreceptors are found in the aorta and the carotid sinus. If the blood pressure within the aorta or carotid sinus increases, the walls of the arteries stretch and stimulate increased activity within the baroreceptors.</span>
Answer:
of diffusion
Explanation:
Molecules move down a concentration gradient without the need to use energy. This means they move from a high concentration to a low concentration. This occurs across a semi-permeable membrane, like the cell membrane, by simple diffusion.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.