Answer:
48 hours
Explanation:
Patch testing is a method to test the allergic reactions called contact dermatitis caused by the allergens found in the environment the patient is surrounded by like home allergens or work allergens.
To perform the test, the allergens are placed on the metal discs which are pasted on the back of the person with hypoallergenic tape.
Then the discs are allowed to be pasted on the back of the person for about 2 days or 48 hours after which the skin is examined for the allergy reactions caused by an allergen in the form of inflammatory response or hypersensitivity.
Thus, 48 hours is the correct answer.
I believe the answer is heart, liver, pituitary gland, kidneys, and skin! hope this helped :)
Answer:
Genetic mapping for unequivocal identification of the potentially causative mutation
Explanation:
Galactosemia is a genetic disorder caused by mutations in the Galactose-1-phosphate uridylyltransferase (GALT) gene, which encodes an enzyme involved in the metabolism of galactose. Gene mapping is a technique widely used in genetics to identify the position of one locus a chromosome by using molecular markers to estimate genetic distances. Genetic mapping provides useful evidence in order to identify when a disease that is transmitted from parent to offspring can be associated with one or more genes and then determine which gene/s is/are responsible for this condition.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
