Allele that causes yellow eyes (Y) is
dominant over the allele that causes orange eyes (y)
Y = 85% = 0.85 and
y = 100% - 85% = 15% = 0.15
f(y) = square root of y = √y = √0.15 =
0.387
frequency of the allele that causes
orange eyes = 0.387
Once we know the value of y, Y + y = 1
Putting the value of y, we get
Y = 1 – 0.387
<span>Frequency of the dominant allele that
causes yellow eyes = 0.61</span>
C. Insulating the body
Insulating the body is not a function of a protein.
Lipids are macromolecules which provide insulation.
<span>A macromolecule is a large molecule. There are four groups of macromolecules: carbohydrates, proteins, nucleic acids and lipids. Lipids consist of glycerol and fatty acids and are constructed from fats, oils, waxes, phospholipids and steroids. A lipid's function is to insulate the body and provide warmth in cold conditions. It can be concluded that a person with very little body fat gets very cold easily and a person with a lot of body fat gets very warm very quickly.
</span>
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
<h2>Mutation & genetic drift</h2>
Explanation:
- A mutation is characterized as a lasting change to the DNA succession in a quality. This change moves the hereditary message conveyed by the quality and can modify the amino corrosive arrangement of the protein the quality encodes. This implies future cells created by the quality will just convey a specific characteristic.
- Genetic Drift is the change in the hereditary structure of a populace after some time because of possibility or irregular occasions. In instances of hereditary float, for example, catastrophic events or periods of irregular climate, the age that makes due to repeat won't really be the fittest, yet the most fortunate. Hereditary float doesn't allude to a particular change in hereditary cells, rather to arbitrary events that impact a population's genetic makeup.
- Hence, the right answer of the fill up the blank is "mutation and genetic drift".
If the The speed of light is approximately 3 × 108 meters per second (m/sec) so the speed of light written in standard numerical form is 300,000,000 m/sec. You will just simply move the place holders to 8 places to the right since the exponent is a positive number. So 3^8= 3x100000000 which is equal to 300,000,000 .
