answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
lesantik [10]
2 years ago
3

Which of the following statements correctly describes osmosis?- In osmosis, water moves across a membrane from areas of lower so

lute concentration to areas of higher solute concentration.- Osmosis only takes place in red blood cells.- Osmosis is an energy-demanding or "active" process.- In osmosis, solutes move across a membrane from areas of lower water concentration to areas of higher water concentration.
Biology
2 answers:
Vilka [71]2 years ago
8 0

Answer:

The correct answer is:  In osmosis, water moves across a membrane from areas of lower solute concentration to areas of higher solute concentration

Explanation:

Osmosis is a phenomena by which water moves through a semipermeable membrane following a concentration gradient. It means that water moves from regions with lower solute concentration to sites of higher solute concentrations. For example, when an individual cell is subjected to a hypertonic solution (a solution with high solute content), water inside the cell tends to get out. This kind of process is spontaneous, it means it does not require energy supply

jeyben [28]2 years ago
4 0

Answer:

a d e

Explanation:

You might be interested in
In a flowering plant, tall (T) is dominant to short (t), and blue flowers (B) is dominant to white flowers (b). A tall plant wit
Bumek [7]
<h3>Answer: </h3><h3 />

25%

<h3>Explanation:</h3>

Following a cross between <u>Ttbb</u> and <u>ttBb</u>, the resulting offspring would be:

TtbB , TtbB , Ttbb , Ttbb , ttbB , ttbB , ttbb , ttbb , TtbB , TtbB , Ttbb , Ttbb , ttbB , ttbB , ttbb , ttbb

To have a clearer idea, see the attached image.

Of the 16 possible combinations from this dihybrid cross, there will be:

4 tall plants with blue flowers

4 tall plants with white flowers

4 short plants with blue flowers

4 short plants with white flowers

There are 4 possible genotypic recombinations that would yield short plants with white flowers out of a possible 16, so the chance that the offspring will be short with white flowers would be 4/16 which is 1/4 or 25%

<h3>Hope this helps</h3>

6 0
2 years ago
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
2 years ago
Name the three molecules that are illustrated in Model 1.
FromTheMoon [43]

Answer:

Pentanol, glucose and fatty acid.

Explanation:

Pentanol, glucose and fatty acid are the three molecules which are present in  the given model number 1. In the model, there are three different molecular diagrams for each molecule. The first one is ball and stick model, the second one is Lewis structure and the third one is line drawing method. All diagrams for a same molecule is totally different from another.

3 0
2 years ago
HELP PLEASE ASAP!!!! I don't understand this
nataly862011 [7]

Answer: D

Explanation: you got the one you click on right so no changes needed.

8 0
2 years ago
Read 2 more answers
What type of molecules will create a solution when mixed with water
kykrilka [37]
I’m not sure if this is what you are asking but, water is polar and therefore any polar molecule will dissolve in water. Same thing goes for non-polar because like dissolves like
6 0
2 years ago
Read 2 more answers
Other questions:
  • In general the surface of a tree has a harder feel than does the surface of a dog. What cell characteristic of each organism can
    5·1 answer
  • Explain the characteristics scientists use when observing organisms and placing them in the six kingdoms .
    8·2 answers
  • When you get your haircut, which type of protein is being cut off? Is it Globular or Fibrous? A. Keratin, Fibrous B. Transport,
    5·1 answer
  • ___ fiber is mainly found in plant cells.
    8·1 answer
  • Which of the following choices correctly matches a tool and its proper application?
    14·1 answer
  • An organ, such as the human liver, is made up of specialized _______ that work together to perform a specific function. A. tissu
    12·2 answers
  • The chemical process by which cells receive nutrients for cell growth and
    5·1 answer
  • Two autosomal genes, J and K, are 60 map units apart. You perform the following testcross: J K / j k x j k / j k. At what freque
    5·1 answer
  • James got sick with an infection called bronchitis. He coughed a lot and had trouble breathing. After a week, James started to f
    15·1 answer
  • Tomato plants usually have hairy stems. Hairless stems are present in tomato plants that are homozygous recessive for this trait
    15·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!