1. DNA unzips in the nucleus.
RNA polymerase binds to the DNA sequence, separates the two strands and creates a single-stranded DNA molecule that will be transcripted.
2. Transcription occurs.
Transcription is the first step of gene expression. During this process, a gene's DNA sequence is copied and a mRNA molecule is produced.
3. mRNA moves to the ribosome
The mRNA is then transferred from the nucleus to the ribosome, the organelle that serves as a site for protein synthesis.
4. Translation occurs
Translation is the process where a mRNA sequence into the amino acid sequence of a polypeptide (protein).
5. Protein assembled at ribosome.
Translation, meaning the formation of a protein, occurs on the ribosome.
Hey there!!!!
The answer is > from my knowledge of horses since I'm an equestrian the nurse should respond saying that if she wore a helmet she wouldn't be here at the hospital. And that she should always were a helmet anything can happen around horses the spook at the slightest thing and they are dangerous but they are majestic creatures and they are amazing but still have a danger side to them.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
c
Explanation:
Underwater earthquakes cause motion throughout ocean water.
1. Pathogens enter the body through a cut in the skin
2. Cells recognize the foreign invaders
3. Histamine is released
4. White blood cells travel to the invaded area
Hope it helps.
