Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
<em>The correct option is C) How does sunlight affect a model of a biogeochemical cycle?</em>
Explanation:
A scientific question can be described as a question based on which a hypothesis can be made and observations and experiments can be performed. The results from these experiments and observations would account for the validation of a hypothesis. Hence, a scientific question should be a question based on which a hypothesis can be made and experiments can be performed.
In the option C, the sunlight might increase or decrease various processes of the biogeochemical cycle. We can hypothesize and perform experiments to get the results. Hence, it is a scientific question.
The most common way these trees undergo pollination is through seeds and pollen.
The pollination is done with help of wind and birds where pollen transform from one plant to another.
<u>Explanation:</u>
The plants that undergoes pollination process through the seeds that are present in it are called as Angiosperms. These contains fruits. The seeds are usually present inside these fruits. Flowering plants are also called as Angiosperms.
These fruits and flowers are absent in gymnosperm. Even then they contain seeds inside the leaves surface. They will undergo pollination with these naked seeds. It is the fruits, flowers and the endosperm that are present in the seeds that help us to find difference between these two. The only common thing that exists between these two are seeds and pollen with which they pollinate.
In gymnosperms, pollen is transferred from male cone to female cone through wind or birds. Now, the pollen is germinated into pollen tubes and sperm for egg fertilization.
Stem cells are cells have not undergone differentiation!
