The temperature insensitive, thermostable, DNA polymerase was extracted from a bacterium found in hot springs can withstand the high temperatures needed to separate the double stranded DNA and the replication process can continue uninterrupted. The enzyme thermus aquaticus can withstand the high temperature used to separate double stranded DNA, so replication does not need to be interrupted by the need to add more enzymes.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
Photosynthesis is the process by which plants make their own food in the presence of sunlight by utilizing carbon-dioxide and water and produces oxygen and energy.
The process of photosynthesis has two types of reactions: light-dependent reactions and light-independent reactions.
The light-dependent reactions occur in the thylakoid membranes of chloroplasts in which plants use light energy to form ATP and the reduced electron carrier NADPH.
In this reaction, photosystem II (P700) absorbs lights energy and passed it to reaction center. this energy is then is transferred to photosystem I (P680), that pump an electron to a high energy level. The high-energy electron then travel to an electron transport chain and releases energy. this released energy pump H+ ions into the thylakoid interior from the stroma and build a gradient H+ ions move through gradient and they pass through ATP synthase resulting in the formation of ATP.
The higher energy electron as moves into an electron transport chain, the electron is passed to NADP+ to form NADPH.
it is a scientific theory because people haven't proven that it it 100% correct we do not know if it is hence the theory..........
