Agglutinins is a antibody or other substance that causes particles to coagulate from another more thickened mass.
They are like security guards in that, they are very slow and lazy so to speak.
Since all of the three beetle species posses the protein, we can use it to determine their relations. We can study the sequence of the amino acids that make the protein and the 3D structure of the protein. The more differences there are in amino acid sequences and the structure of the protein, the species are more distantly related because they have diverged a long time ago and their genes that produce that protein have undergone many changes over time.
The remains of plants and animals preserved in the earth => fossils
coal, oil, natural gas => fuels
fossil fuels
Overall, minerals from animal products are better absorbed than those from plant because binders such as fiber are not present to hinder absorption.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
