<span>T he type of selection that favored progressively larger brain size in human evolution is
</span>directional selection. Directional selection is a type of natural selection (besides stabilizing selection, disruptive selection, kin selection,..)<span> in which an extreme phenotype is favored over other phenotypes. Because progressively larger brain size is an extreme phenotype this is a directional selection.</span>
Answer:
Bb, Db
, Bd and Dd
Explanation:
When a cross between two parents (having certain trait) is carried out , they share their alleles with each other to produce offspring with new traits. These offspring have gentically different allele combination as compared to their parents. A genetic cross can be represented by a punnet square (as given below)
The cross between two parents with genotype "BD" and "bd" will result into the following offspring -
B D
b Bb Db
d Bd Dd
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer;
B. improved ecosystem health
Explanation;
-Surface mining is a method of extracting minerals near the surface of the Earth. The three most common types of surface mining are open-pit mining, strip mining, and quarrying.
-The environmental impact of mining includes erosion, formation of sinkholes, loss of biodiversity, and contamination of soil, groundwater, and surface water by chemicals from mining processes.The environmental effects of surface mining include;
- Habitat destruction
- Soil erosion
-
Air pollution from dust particulates
-
Pollution (especially from sediments)
-
All surface mining techniques negatively affect the environment, though some methods are more damaging than others.
Answer: dandelion is consumed by bees, grasshoppers, and butterflies.
