Answer:
B: I saw it an hour ago and I didn't want to answer because there are too many ifs. I tried, but it could be wrong.
Explanation:
This is not as simple as it sounds and I have a feeling that the correct answer is in the head of the person designing the question. In other words, I could easily get it wrong.
It depends on whether the tide is going in or going out to start with. The question would be a whole lot easier if the bottle was dropped miles from shore.
A: The bottle is capped. A is certainly not true. The low density of the bottle will keep it afloat until something happens that determines it's permanent direction. Not A.
B: It will if nothing else influences it. There will always be waves around that will insure an up and down movement. This is a possible answer, but not a certain one. A five year old could not throw it very far to start with. Let's read the rest.
C: Maybe. It has happened. The bottle needs a good start and the tide going out to happen. Let's read the last 2.
D: Not in a million. Not D.
E: It won't be still. The ocean is always moving. Not E.
I'm going to pick B, but it is not a slam dunk.
Answer is a. therapeutic communities.
Therapeutic communities are a common form of long-term residential treatment for substance use disorders. These communities provide drug-free environments in which people with addictive problems live together in an organized and structured manner to promote change toward recovery and re-socialization. Some such groups evolved into self-supporting and democratically run residences to support abstinence and recovery from drug use.
Muskrats eat oak trees and if the oak tree had a disease and all of them died. then the muskrat would have to relie on someething else to eat because muskrats eat oak trees.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
A, because a study showing that people tend to perceive GMO labeled foods as bad reinforces the reason given that labels reinforce stigmas about said products.
