Answer:
Please see below
Explanation:
Between all these kids carrying out this discussion, Tamara is the closest to guessing what scientists do. There is indeed a definite set of steps that scientists undertake in order to conduct science experiments. The scientific method is as follows:
- observation
- measurement
- experiment
- testing the hypothesis
Answer: The correct option is A
Archae bacteria are extremophiles which thrive in extremely environment.
Explanation:
Extremophiles are organisms that inhabit extreme environments. They thrive in hot niches, ice, and salt solutions. Some of them grow in toxic waste, organic solvents and heavy metals. Extremophiles include members of all domains of life which are bacteria, archea,and eukaryotes. Out of these three members of extremophiles, archea are the main group of microorganisms to thrive in extreme environments. This is because the archea are skilled in adapting to different extreme conditions than bacteria and eukaryotes.
Archea are hyper thermophilic microorganisms.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
The answer is:
The F1 generation will have all cleft chin.
The P generation and F2<span> generation will have cleft chins and no-cleft chin.</span>
<span>Scientists use the word gender/sex to refer exclusively to biological differences between men and women in anatomy, genetics, or physical functioning. Gender/sex is determined if the person is a female or male. It’s basically the word that most of the forms have in order to know the preference of the person filling up the forms or any other documents. </span>
