Answer;
Responsiveness
Excretion
Explanation;
Excess carbon dioxide must be removed from the body to stop it reaching toxic levels. As the blood flows through the lungs, excess carbon dioxide passes out of the blood and into the alveoli by diffusion. It is then removed from the lungs when we exhale (breathe out).
-Carbon dioxide helps remove carbon dioxide (a waste gas that can be toxic) from your body. The lungs' intake of oxygen and removal of carbon dioxide is called gas exchange. Gas exchange is part of breathing.
It is the Flow of energy, where R is the energy used in Respiration by the organisms, whose magnitude with Gross production equals to Net production.
messenger RNA (mRNA) carries a transcript (copy) of the DNA's instructions out of the nucleus to the cytoplasm where it attaches to a ribosome.
transfer RNA (tRNA) begins to read (translate) the information on the attached mRNA and corresponding to this information, fetches the appropriate amino acids from the pool of free amino acids in the cytoplasm, and brings them to the ribosome where they are linked into a chain or polymer forming the primary structure of the desired protein.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
It depends what kind of water.
Explanation:
Salt water:
You would need a negative buoyancy.
Fresh water:
You would need a neutral buoyancy.
Please let me know if I am wrong!