answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
ArbitrLikvidat [17]
2 years ago
15

Leonardo is a five-year-old boy. While playing on the shore, he threw an empty, capped, plastic bottle into the waves. What do y

ou think is likely to happen?
A. The bottle will sink to the bottom of the ocean.
B. The bottle will keep bobbing up and down.
C. The bottle will be carried across the ocean to a distant place.
D. The bottle will result in a series of tsunamis.
E. The bottle will remain floating still on the ocean water.
Biology
1 answer:
Orlov [11]2 years ago
5 0

Answer:

B: I saw it an hour ago and I didn't want to answer because there are too many ifs. I tried, but it could be wrong.

Explanation:

This is not as simple as it sounds and I have a feeling that the correct answer is in the head of the person designing the question. In other words, I could easily get it wrong.

It depends on whether the tide is going in or going out to start with. The question would be a whole lot easier if the bottle was dropped miles from shore.

A: The bottle is capped. A is certainly not true. The low density of the bottle will keep it afloat until something happens that determines it's permanent direction. Not A.

B: It will if nothing else influences it. There will always be waves around that will insure an up and down movement. This is a possible answer, but not a certain one. A five year old could not throw it very far to start with. Let's read the rest.

C: Maybe. It has happened. The bottle needs a good start and the tide going out to happen.  Let's read the last 2.

D: Not in a million. Not D.

E: It won't be still. The ocean is always moving. Not E.

I'm going to pick B, but it is not a slam dunk.

You might be interested in
Describe a body position that can exist when all major body parts are flexed
Amanda [17]
The positioning of the body where are major body parts are flexed is called the fetal position. In this position the back is arched forward and arms and legs are drawn closer to the torso and the head bowed. It is called this because this is the position the fetus is in as it develops in the womb.  
3 0
2 years ago
A female with an X-linked dominant disease mates with a normal male. Based on the pedigree chart, the possibility that her offsp
Naya [18.7K]

Answer:

50%

Explanation:

A pedigree chart is a chart that defines the incident and the presence of a specific organism and its ancestor from generation one to the another generation like humans, racehorses, etc

Here in the given situation, it is mentioned that the a female which is with an X-linked associated with a normal male

So based on the above information, the possibilities should be 50%

4 0
2 years ago
Assume you are investigating the inheritance of stem length in pea plants. You cross-pollinate a short-stemmed plant with a long
beks73 [17]

Answer:

75% would have long stems and 25% would have short stems.

Explanation:

7 0
2 years ago
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
2 years ago
An undersupply of the major inhibitory neurotransmitter known as ________ is linked to seizures.
bazaltina [42]

Answer:

Gamma-aminobutyric acid (GABA)

Explanation:

Epileptic seizures are induced by a preponderance of electrical activity within the network of neurons in the brain. Synapsis is the meeting point between the axon of one neuron and the dendrite of another neuron. Electrical signals don't cross through the synapsis, instead, they are conveyed in a chemical form by neurotransmitters.

The neurotransmitters convey messages across the synapsis in a chemical form until they find to the receptor of the dendrite of the receiving neuron. Neurotransmitters can either be excitatory or inhibitory in function i.e. the receiving neuron can either be stimulated to action or inhibited from action. The main excitatory and inhibitory neurotransmitters in the brain are Glutamate and Gamma-aminobutyric acid (GABA) respectively.

There must be a balance between excitation and inhibition of neurons, in order to ascertain the optimal functioning of the brain. Too much Glutamate or too little of GABA can make neurons hyperexcitable and hyperexcitability of neurons makes the brain susceptible to seizures.

8 0
2 years ago
Other questions:
  • Vegetation type of drought-resistant grasses also refers to a very dry climate, characteristic of southern russia, ukraine, and
    13·1 answer
  • Which three statements are supported by the data in the food label?
    11·1 answer
  • Draw the non cyclic amp molecule after it has dissolved in water
    14·1 answer
  • Which procedures were followed in this lab to decrease experimental error? Check all that apply. repeating the experiment three
    8·2 answers
  • A scientist is observing a worm that was found inside a host. The worm that's an outer body that is smooth and soft. Which worm
    5·2 answers
  • We can be sure that a mole of table sugar and a mole of vitamin C are equal in their
    9·1 answer
  • Which of the following examples poses the greatest potential threat to an ecosystem’s biodiversity?
    6·1 answer
  • Imagine that you could dive deep into the Atlantic Ocean where the South American Plate and African Plate meet at a plate bounda
    10·1 answer
  • You keep your ecosphere in a sunny spot on your desk next to the window. Your little sister, thinking it's a melted ice pack, pu
    6·1 answer
  • Why is aeration important in the tissue organ bath system?
    12·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!