Answer:
The factors which remained constant are as follows -
- material used as the membrane
- amount of substances used
- number of trials
The factors which have shown variation are as follows -
- molecule size (large starch molecules vs. small glucose molecules)
- whether the molecules diffused through the membrane (tubing)
Explanation
Some factors with in the experiments remained constant from the point of starting of the experiment to its end. While some factors were varied to study its impact on the experiment rate of progression or on the final product formed. Thus , out of the following given factors, the ones that remained constant are -
- material used as the membrane
- amount of substances used
- number of trials
The factors which have shown variation are as follows -
- molecule size (large starch molecules vs. small glucose molecules)
- whether the molecules diffused through the membrane (tubing)
The ICD-10-PCS code is 30240G4.
Firstly, select "Administration" (section 3) because the procedure is the administration of bone marrow to the patient. Secondly, select "Circulatory" (section 30) because it is being administered in a vein (circulatory system). Third, select "Transfusion" (section 302) because it is being done a transfusion of bone marrow. Then select "Central Vein" (section 3024) because that's the place of administration in the circulatory system. Lastly, go to "Bone Marrow" (section 30240G) as that is what's being transfused and then choose "Transfusion of Allogeneic Unspecified Bone Marrow into Central Vein, Open Approach" (<span>30240G4) because it is not specified what type of transfusion it is.</span>
Answer:
Oi Boa tarde a todos os dias de férias e não compensa eu ir pra casa. O que é bom pra mim, e o que eu faço pra comprar um carro de lenha por que não Internet Explorer. Por isso, o que eu faço pra comprar um carro de lenha
Answer:
The correct options are B "The unusual F1 female is heterozygous for a reciprocal balanced translocation involving the chromosome with the apricot, bristle and clipped loci" and D "Independent assortment of non-compatible chromosome structures (i.e., translocated and normal chromosomes segregating together) in the F1 female led to the 90 eggs that aborted development"
Explanation:
The unexpected results obtained earlier can be attributed to the two factors listed above. At the time when meisois takes place, there is the process of independent assortment which leads to formation of zygotes. Due to the event of translocation, the eggs produced lacked some critical development genes.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
